Cat: PA2000-6606

Recombinant Human CDH2 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    CDH2

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    CDH2; CDHN; NCAD; Cadherin-2; CDw325; Neural cadherin; N-cadherin; CD antigen CD325

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P19022

  • Expression Region

    160-724aa

  • AA Sequence

    DWVIPPINLPENSRGPFPQELVRIRSDRDKNLSLRYSVTGPGADQPPTGI FIINPISGQLSVTKPLDREQIARFHLRAHAVDINGNQVENPIDIVINVID MNDNRPEFLHQVWNGTVPEGSKPGTYVMTVTAIDADDPNALNGMLRYRIV SQAPSTPSPNMFTINNETGDIITVAAGLDREKVQQYTLIIQATDMEGNPT YGLSNTATAVITVTDVNDNPPEFTAMTFYGEVPENRVDIIVANLTVTDKD QPHTPAWNAVYRISGGDPTGRFAIQTDPNSNDGLVTVVKPIDFETNRMFV LTVAAENQVPLAKGIQHPPQSTATVSVTVIDVNENPYFAPNPKIIRQEEG LHAGTMLTTFTAQDPDRYMQQNIRYTKLSDPANWLKIDPVNGQITTIAVL DRESPNVKNNIYNATFLASDNGIPPMSGTGTLQIYLLDINDNAPQVLPQE AETCETPDPNSINITALDYDIDPNAGPFAFDLPLSPVTIKRNWTITRLNG DFAQLNLKIKFLEAGIYEVPIIITDSGNPPKSNISILRVKVCQCDSNGDC TDVDRIVGAGLGTGA

  • Molecular Weight

    99 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

CDH2, also known as N-cadherin, is a type of cadherin, a family of proteins that play crucial roles in cell adhesion, which is vital for the development and maintenance of tissue structure in multicellular organisms. CDH2 is primarily expressed in neural and muscle tissues, and its function is essential for facilitating cell-cell interactions during embryonic development, wound healing, and in the maintenance of tissue integrity. Research has shown that dysregulation of CDH2 expression is associated with various pathologies, including cancer metastasis, where its reduced expression correlates with the loss of cellular adhesion and increased cell migration. The study and production of recombinant CDH2 proteins have become increasingly important for elucidating its biological functions and for developing therapeutic strategies aimed at inhibiting cancer progression. Recombinant CDH2 proteins are utilized in various assays and experimental setups to better understand the molecular mechanisms underlying cell adhesion, signal transduction, and cellular communication. These studies also provide insights into potential biomarkers for disease progression and therapeutic targets. As such, recombinant CDH2 proteins represent an invaluable tool in biomedical research aimed at understanding not only fundamental biological processes but also disease mechanisms and potential interventions. The ongoing exploration of CDH2's role in health and disease highlights the protein's importance in both basic biological research and its translational applications in medicine.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US