Analytical Data
-
Gene name
MDC1
- Application
-
Alternative Names
MDC1；KIAA0170；NFBD1；Mediator of DNA damage checkpoint Protein 1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q14676
-
Expression Region
1892-2082aa
-
AA Sequence
APKVLFTGVVDARGERAVLALGGSLAGSAAEASHLVTDRIRRTVKFLCALGRGIPILSLDWLHQSRKAGFFLPPDEYVVTDPEQEKNFGFSLQDALSRARERRLLEGYEIYVTPGVQPPPPQMGEIISCCGGTYLPSMPRSYKPQRVVITCPQDFPHCSIPLRVGLPLLSPEFLLTGVLKQEAKPEAFVLS
-
Molecular Weight
22.9 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
MDC1 (mediator of DNA damage checkpoint 1) is a pivotal protein involved in the cellular response to DNA damage, particularly in the context of DNA double-strand breaks (DSBs). Understanding its role is crucial as DSBs can lead to genomic instability and are implicated in various cancers. MDC1 acts as a molecular scaffold, recruiting other proteins to the sites of DNA damage, thus facilitating the DNA damage response (DDR) pathway. The research on recombinant MDC1 proteins has gained momentum due to their potential applications in cancer therapeutics and diagnostics. By expressing and purifying MDC1 in vitro, researchers can explore its structural and functional properties in greater detail, allowing for the identification of interactions with other DDR proteins. Furthermore, recombinant MDC1 can be utilized to develop assays to screen for inhibitors or modulating agents that might enhance the efficacy of DNA damage-inducing therapies, such as radiotherapy and certain chemotherapeutics. There is also an interest in understanding how post-translational modifications of MDC1 affect its function and interactions, which could reveal new avenues for therapeutic intervention. Consequently, the study of MDC1 recombinant proteins is not only significant for basic science in understanding the DNA damage response but also has the potential to inform clinical strategies for tackling cancer and other diseases linked to genomic instability.
