Analytical Data
-
Gene name
SLC35A2
- Application
-
Alternative Names
SLC35A2; UGALT; UGT; UGTL; UDP-galactose translocator; Solute carrier family 35 member A2; UDP-galactose transporter; UDP-Gal-Tr; UGT
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P78381
-
Expression Region
1-242 aa
-
AA Sequence
MAAVGAGGSTAAPGPGAVSAGALEPGTASAAHRRLKYISLAVLVVQNASLILSIRYARTLPGDRFFATTAVVMAEVLKGLTCLLLLFAQKRGNVKHLVLFLHEAVLVQYVDTLKLAVPSLIYTLQNNLQYVAISNLPAATFQPSPRCSQSHSLCLCLRLRALRSPAASRAATTTAAVFPPWRPHHGALSAKVSAGEVRAGSNGGTQGRGTGVEGVGHLQDPSRHPPGPGSSGFGRWSFLPGH
-
Molecular Weight
52.36 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
SLC35A2 is a member of the solute carrier family, specifically classified as a nucleotide-sugar transporter. It plays a critical role in the transport of nucleotide sugars, which are essential precursors for glycosylation processes, influencing cell adhesion, signaling, and overall cellular function. Mutations in the SLC35A2 gene are associated with a range of diseases, including congenital disorders of glycosylation (CDGs), which manifest as neurological, developmental, and systemic anomalies. Recent research has focused on understanding the structure-function relationship of the SLC35A2 protein, as this could provide insights into the molecular mechanisms underlying the pathophysiology of CDGs. The reconstitution of SLC35A2 in a controlled environment allows for detailed studies of its transport activity, substrate specificity, and interactions with other cellular components. Moreover, understanding the protein's role in cell biology may pave the way for developing targeted therapies to ameliorate the effects of SLC35A2-related disorders. Thus, the investigation of SLC35A2 recombinant protein is not only vital for elucidating its biological functions but also holds potential for clinical applications in treating glycosylation defects.
