Analytical Data
-
Gene name
SPO11
- Application
-
Alternative Names
SPO11
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9Y5K1
-
Expression Region
1-396 aa
-
AA Sequence
MAFAPMGPEASFFDVLDRHRESLLAALRRGGREPPTGGSRLASSSEVLASIENIIQDIITSLARNEAPAFTIDNRSSWENIKFEDSVGLQMVSHCTTRKIKSDSPKSAQKFSLILKILSMIYKLVQSNTYATKRDIYYTDSQLFGNQTVVDNIINDISCMLKVSRRSLHILSTSKGLIAGNLRYIEEDGTKVNCTCGATAVAVPSNIQGIRNLVTDAKFVLIVEKDATFQRLLDDNFCNKLSPCIMITGKGVPDLNTRLLVKKLWDTFHVPVFTLVDADPHGIEIMCIYKYGSMSMSFEAHHLTVPAIRWLGLLPSDLKRLNVPKDSLIPLTKRDQMKLDSILRRPYVTCQPFWRKEMEIMADSKMKAEIQALTFLSSDYLSRVYLPNKLKFGGWI
-
Molecular Weight
47.3 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
SPO11 is a key protein involved in the initiation of meiotic recombination, a critical process for sexual reproduction in eukaryotic organisms. It functions primarily by introducing double-strand breaks in DNA, creating the necessary substrate for homologous recombination. The understanding of SPO11 and its mechanisms has significant implications for genetics and agriculture, as it influences genetic diversity and chromosomal stability during meiosis. Research on SPO11 began with studies in model organisms such as yeast and mice, revealing its essential role in pairing homologous chromosomes and facilitating genetic exchange. Investigations into SPO11 have expanded to explore its regulation, the biochemical pathways it influences, and its interactions with other proteins involved in the meiotic process. This research has also highlighted the potential consequences of SPO11 dysfunction, which can lead to infertility and various genetic disorders. Recent advances in molecular biology techniques, including CRISPR-Cas9 and advanced sequencing, have enabled deeper insights into the role of SPO11, paving the way for potential applications in animal breeding and crop improvement strategies. The ongoing study of SPO11 continues to enhance our understanding of meiosis and its broader implications in evolutionary biology and medicine.











