Analytical Data
-
Gene name
ZA20D2
- Application
-
Alternative Names
AN1-type zinc finger Protein 5; ZA20D2; ZFAN5_HUMAN; Zfand5; ZFAND5A; zinc finger A20 domain containing 2; Zinc finger A20 domain containing Protein 2; Zinc finger A20 domain-containing Protein 2; zinc finger AN1 type domain 5; Zinc finger Protein 216; ZNF216
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O76080
-
Expression Region
1-213 aa
-
AA Sequence
MAQETNQTPGPMLCSTGCGFYGNPRTNGMCSVCYKEHLQRQQNSGRMSPMGTASGSNSPTSDSASVQRADTSLNNCEGAAGSTSEKSRNVPVAALPVTQQMTEMSISREDKITTPKTEVSEPVVTQPSPSVSQPSTSQSEEKAPELPKPKKNRCFMCRKKVGLTGFDCRCGNLFCGLHRYSDKHNCPYDYKAEAAAKIRKENPVVVAEKIQRI
-
Molecular Weight
49.5 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ZA20D2 is a recombinant protein that has garnered attention in the field of molecular biology and biochemistry due to its potential applications in therapeutic development and biochemical research. This protein is derived from a specific gene sequence identified in a particular organism, which exhibits unique structural and functional properties. Researchers have focused on ZA20D2 because of its involvement in various biological processes, such as signal transduction and cellular regulation. The expression and purification of ZA20D2 using recombinant DNA technology enable scientists to explore its functional role in cellular mechanisms and disease pathways. Additionally, the ability to produce this protein in a controlled laboratory setting allows for extensive study of its interactions with other biomolecules and its potential implications in drug development. Ongoing research aims to elucidate the mechanism of action of ZA20D2, assess its stability and efficacy in different biological contexts, and investigate its potential as a biomarker or therapeutic agent. The insights gained from studying this protein could contribute significantly to our understanding of fundamental biological processes and the development of innovative therapeutic strategies for various diseases.
