Analytical Data
-
Gene name
ZDHHC21
- Application
-
Alternative Names
ZDHHC21; Palmitoyltransferase ZDHHC21; DHHC domain-containing cysteine-rich Protein 21; DHHC-21; Zinc finger DHHC domain-containing Protein 21
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8IVQ6
-
Expression Region
1-265 aa
-
AA Sequence
MGLRIHFVVDPHGWCCMGLIVFVWLYNIVLIPKIVLFPHYEEGHIPGILIIIFYGISIFCLVALVRASITDPGRLPENPKIPHGEREFWELCNKCNLMRPKRSHHCSRCGHCVRRMDHHCPWINNCVGEDNHWLFLQLCFYTELLTCYALMFSFCHYYYFLPLKKRNLDLFVFRHELAIMRLAAFMGITMLVGITGLFYTQLIGIITDTTSIEKMSNCCEDISRPRKPWQQTFSEVFGTRWKILWFIPFRQRQPLRVPYHFANHV
-
Molecular Weight
57.8 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ZDHHC21, a member of the ZDHHC (zinc finger DHHC-type containing) family, plays a crucial role in the post-translational modification of proteins through palmitoylation, a reversible lipid modification that affects various cellular processes. This modification is essential for the regulation of protein localization, stability, and interactions, influencing critical pathways including cell signaling, neuronal function, and viral infection. Recent studies have highlighted the significance of ZDHHC21 in the context of neurodevelopmental disorders and cancer, with mutations in the gene linked to altered cellular functions. The recombinant expression of ZDHHC21 allows for detailed investigations into its enzymatic activity, substrate specificity, and the structural features that govern its function. Furthermore, understanding the dynamics of ZDHHC21-mediated palmitoylation is vital for uncovering its role in health and disease, making it a promising target for therapeutic interventions. Research on ZDHHC21 not only contributes to basic biological knowledge but also aids in the development of novel strategies for treating conditions associated with disturbed palmitoylation processes. As such, the recombinant protein serves as a valuable tool for advancing our comprehension of this essential regulatory mechanism in cellular biology.
