Analytical Data
-
Gene name
SDHA
- Application
-
Alternative Names
SDHA；SDH2；SDHF；Succinate dehydrogenase [ubiquinone] flavoProtein subunit. mitochondrial
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P31040
-
Expression Region
44-293aa
-
AA Sequence
SAKVSDSISAQYPVVDHEFDAVVVGAGGAGLRAAFGLSEAGFNTACVTKL FPTRSHTVAAQGGINAALGNMEEDNWRWHFYDTVKGSDWLGDQDAIHYMT EQAPAAVVELENYGMPFSRTEDGKIYQRAFGGQSLKFGKGGQAHRCCCVA DRTGHSLLHTLYGRSLRYDTSYFVEYFALDLLMENGECRGVIALCIEDGS IHRIRAKNTVVATGGYGRTYFSCTSAHTSTGDGTAMITRAGLPCQDLEFV
-
Molecular Weight
54 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
SDHA (Succinate Dehydrogenase A) is a crucial enzyme in the tricarboxylic acid (TCA) cycle and plays an essential role in cellular respiration by facilitating the conversion of succinate to fumarate while simultaneously contributing to the electron transport chain. Research on SDHA has gained significant attention due to its involvement in various biological processes and its association with hereditary and sporadic tumors, particularly paragangliomas and pheochromocytomas. Mutations in the SDHA gene can lead to a loss of enzyme activity, resulting in accumulated succinate, which acts as an oncometabolite and promotes tumorigenesis through pathways that influence cellular signaling and gene expression. Additionally, the study of SDHA and its recombinant protein forms has potential applications in drug discovery, cancer therapy, and metabolic disease studies. By characterizing this enzyme at a molecular level, researchers aim to develop therapeutic strategies to target SDHA-related metabolic dysregulation and provide insights into its role in the pathophysiology of SDHA-associated conditions. The production of recombinant SDHA allows for in-depth biochemical analysis, structural studies, and the exploration of enzyme inhibitors that may offer new avenues for cancer treatment.
