Analytical Data
-
Gene name
MUC5B
- Application
-
Alternative Names
MUC5B；MUC5；Mucin-5B
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9HC84
-
Expression Region
4186-4295aa
-
AA Sequence
ELGQVVECSLDFGLVCRNREQVGKFKMCFNYEIRVFCCNYGHCPSTPATSSTAMPSSTPGTTWILTELTTTATTTASTGSTATPSSTPGTAPPPKVLTSPATTPTATSSK
-
Molecular Weight
18.9 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
MUC5B is a high molecular weight glycoprotein that plays a crucial role in maintaining mucosal barriers and protecting epithelial surfaces, particularly in the respiratory and gastrointestinal tracts. As a primary component of mucus, MUC5B is involved in various physiological functions such as hydration, pathogen defense, and facilitation of clearance of foreign particles. Recent studies have highlighted its significance in disease processes, including chronic obstructive pulmonary disease (COPD), asthma, and cystic fibrosis, where altered MUC5B expression can lead to impaired mucociliary function and inflammation. Importantly, genetic variations in the MUC5B gene have been linked to an increased risk of pulmonary diseases, making it a target for therapeutic interventions. The recombinant production of MUC5B has emerged as a valuable approach for studying its structure-function relationships and exploring its potential as a biomarker or therapeutic agent. Research on the recombinant form of this protein allows for the assessment of its biochemical properties, interactions with other molecules, and its role in disease mechanisms. This growing body of knowledge may pave the way for novel strategies in the management of mucosal diseases and further our understanding of mucin biology.
