Analytical Data
-
Gene name
MUC7
- Application
-
Alternative Names
MUC7；MG2；Mucin-7
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8TAX7
-
Expression Region
23-377aa
-
AA Sequence
RERDHELRHRRHHHQSPKSHFELPHYPGLLAHQKPFIRKSYKCLHKRCRPKLPPSPNNPPKFPNPHQPPKHPDKNSSVVNPTLVATTQIPSVTFPSASTKITTLPNVTFLPQNATTISSRENVNTSSSVATLAPVNSPAPQDTTAAPPTPSATTPAPPSSSAPPETTAAPPTPSATTQAPPSSSAPPETTAAPPTPPATTPAPPSSSAPPETTAAPPTPSATTPAPLSSSAPPETTAVPPTPSATTLDPSSASAPPETTAAPPTPSATTPAPPSSPAPQETTAAPITTPNSSPTTLAPDTSETSAAPTHQTTTSVTTQTTTTKQPTSAPGQNKISRFLLYMKNLLNRIIDDMVEQ
-
Molecular Weight
95.7 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
MUC7, a member of the mucin family, plays a crucial role in the body’s defense mechanisms, particularly in the oral cavity and respiratory tract. As a glycoprotein, MUC7 is secreted by salivary glands and contributes to the formation of a protective mucosal barrier, facilitating lubrication, pathogen clearance, and maintaining oral health. The interest in MUC7 recombinant protein stems from its potential applications in therapeutic and diagnostic fields, particularly in treating conditions like dry mouth (xerostomia) and respiratory diseases. Advances in recombinant DNA technology enable the production of MUC7 in host systems, allowing for high yield and purity that can be used for further studies. Research involving MUC7 focuses on its structural biology, functional properties, and interactions with pathogens, which are pivotal for designing novel antimicrobial agents. Furthermore, MUC7's role in maintaining homeostasis and its involvement in various diseases makes it an attractive candidate for biomarker development and personalized medicine. Overall, studying MUC7 recombinant protein not only enhances the understanding of mucosal biology but also opens new avenues for innovative therapeutic strategies.
