Analytical Data
-
Gene name
NB1
- Application
-
Alternative Names
NB1；NB1；PRV1；CD177 antigen
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8N6Q3
-
Expression Region
22-321aa
-
AA Sequence
LLCQFGTVQHVWKVSDLPRQWTPKNTSCDSGLGCQDTLMLIESGPQVSLVLSKGCTEAKDQEPRVTEHRMGPGLSLISYTFVCRQEDFCNNLVNSLPLWAPQPPADPGSLRCPVCLSMEGCLEGTTEEICPKGTTHCYDGLLRLRGGGIFSNLRVQGCMPQPGCNLLNGTQEIGPVGMTENCNRKDFLTCHRGTTIMTHGNLAQEPTDWTTSNTEMCEVGQVCQETLLLLDVGLTSTLVGTKGCSTVGAQNSQKTTIHSAPPGVLVASYTHFCSSDLCNSASSSSVLLNSLPPQAAPVPG
-
Molecular Weight
63.6 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
NB1, also known as Neural-Basal cell 1, is a recombinant protein that has garnered significant attention in the field of biological and medical research due to its potential roles in cellular processes and disease mechanisms. Originally identified in studies of cellular signaling and differentiation, NB1 has been implicated in various physiological and pathological contexts, including neurobiology, cancer, and immunology. Researchers are particularly interested in its involvement in the modulation of immune responses and its potential as a therapeutic target. The recombinant production of NB1 enables the study of its structure-function relationships, facilitating the investigation of its biological roles and interactions with other cellular components. Advances in biotechnology have made it possible to produce large quantities of high-purity NB1 for detailed functional assays, aiding in the elucidation of its mechanisms of action. Understanding the role of NB1 in cellular pathways may lead to novel therapeutic strategies for diseases in which it plays a critical part. Ongoing research continues to explore the diverse applications of NB1 as a biomarker for disease progression and as a candidate for targeted therapies, reflecting its relevance in contemporary scientific inquiry.
