Analytical Data
-
Gene name
FSTL4
- Application
-
Alternative Names
Follistatin like 4; Follistatin related protein 4; Follistatin-like protein 4; Follistatin-related protein 4; FSTL 4; FSTL4; FSTL4_HUMAN; KIAA1061
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q6MZW2
-
Expression Region
1-605aa
-
AA Sequence
MKPGGFWLHLTLLGASLPAALGWMDPGTSRGPDVGVGESQAEEPRSFEVTRREGLSSHNELLASCGKKFCSRGSRCVLSRKTGEPECQCLEACRPSYVPVCGSDGRFYENHCKLHRAACLLGKRITVIHSKDCFLKGDTCTMAGYARLKNVLLALQTRLQPLQEGDSRQDPASQKRLLVESLFRDLDADGNGHLSSSELAQHVLKKQDLDEDLLGCSPGDLLRFDDYNSDSSLTLREFYIAFQVVQLSLAPEDRVSVTTVTVGLSTVLTCAVHGDLRPPIIWKRNGLTLNFLDLEDINDFGEDDSLYITKVTTIHMGNYTCHASGHEQLFQTHVLQVNVPPVIRVYPESQAQEPGVAASLRCHAEGIPMPRITWLKNGVDVSTQMSKQLSLLANGSELHISSVRYEDTGAYTCIAKNEVGVDEDISSLFIEDSARKTLANILWREEGLSVGNMFYVFSDDGIIVIHPVDCEIQRHLKPTEKIFMSYEEICPQREKNATQPCQWVSAVNVRNRYIYVAQPALSRVLVVDIQAQKVLQSIGVDPLPAKLSYDKSHDQVWVLSWGDVHKSRPSLQVITEASTGQSQHLIRTPFAGVDDFFIPPINLEQ
-
Molecular Weight
93.6 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
FSTL4 (Follistatin-like protein 4) is a member of the follistatin family of proteins, which play crucial roles in various biological processes, including cell proliferation, differentiation, and apoptosis. Recent studies have highlighted FSTL4's involvement in regulating inflammatory responses and its potential implications in various diseases, such as cancer, cardiovascular disorders, and autoimmune conditions. Researchers have been particularly interested in its role in modulating the activity of growth factors and cytokines, which are critical for maintaining cellular homeostasis and tissue repair. Additionally, FSTL4's expression patterns are often altered in pathological conditions, making it a potential biomarker for disease progression. The recombinant form of FSTL4 is being investigated for its therapeutic potential, as it could serve as a tool for studying the mechanisms underlying its biological functions and interactions with other proteins. This research aims to deepen our understanding of FSTL4's role in health and disease, potentially leading to innovative treatment strategies targeting inflammatory and degenerative disorders.
