Analytical Data
-
Gene name
FZD3
- Application
-
Alternative Names
FZD3; Frizzled-3; Fz-3; hFz3
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9NPG1
-
Expression Region
55-157aa
-
AA Sequence
QQTAALAMEPFHPMVNLDCSRDFRPFLCALYAPICMEYGRVTLPCRRLCQRAYSECSKLMEMFGVPWPEDMECSRFPDCDEPYPRLVDLNLAGEPTEGAPVAV
-
Molecular Weight
37.07 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
FZD3, or Frizzled class receptor 3, is a key member of the Frizzled family of G protein-coupled receptors that play a critical role in the Wnt signaling pathway, which is essential for various developmental processes and cellular functions. The FZD3 protein is known to be involved in regulating cell proliferation, differentiation, and polarity, and has implications in neurodevelopmental processes, as well as in cancer biology. Research has identified FZD3 as a crucial player in brain development and function, particularly in neuronal connectivity and synaptic plasticity. Additionally, alterations in FZD3 expression have been linked to various pathological conditions, including neurodegenerative diseases and tumors. The study of recombinant FZD3 protein is significant for understanding the molecular mechanisms of Wnt signaling and its effects on cellular behavior. By generating recombinant FZD3, researchers can investigate its structure-function relationships, identify potential ligand interactions, and explore its role in mediating downstream signaling pathways. This research not only contributes to the fundamental understanding of developmental biology but also holds therapeutic potential, providing insights for the development of interventions targeting Wnt-related disorders. The recombinant FZD3 protein serves as a valuable tool for biochemical assays, structural studies, and potential drug discovery efforts aimed at modulation of the Wnt signaling pathway. Ultimately, further characterization of FZD3 could yield new avenues for treating conditions associated with dysregulated Wnt signaling, highlighting its importance in both fundamental and translational research.
