Cat: IPD-X50125

Recombinant Human TREM2 Protein,N-6His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    TREM2

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    TREM2;Triggering receptor expressed on myeloid cells 2

  • Species

    Human

  • Source

    E. coli

  • Tag

    N-6His

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q9NZC2

  • Expression Region

    19-174aa

  • AA Sequence

    HNTTVFQGVAGQSLQVSCPYDSMKHWGRRKAWCRQLGEKGPCQRVVSTHN LWLLSFLRRWNGSTAITDDTLGGTLTITLRNLQPHDAGLYQCQSLHGSEA DTLRKVLVEVLADPLDHRDAGDLWFPGESESFEDAHVEHSISRSLLEGEI PFPPTS

  • Molecular Weight

    21kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

TREM2 (Triggering Receptor Expressed on Myeloid Cells 2) is an immune receptor predominantly expressed on microglia, the resident immune cells of the central nervous system. Recent research has highlighted its critical role in neuroinflammation and neurodegenerative diseases, particularly Alzheimer's disease. Mutations in the TREM2 gene have been linked to an increased risk of developing late-onset Alzheimer's, suggesting that TREM2 signaling pathways are essential for maintaining brain homeostasis and modulating inflammatory responses. Given its significance, the production of recombinant TREM2 protein has gained prominence in scientific research, allowing for detailed studies on its structure, function, and interactions with various ligands. Understanding the mechanisms by which TREM2 operates can provide insights into its protective roles in the brain and promote the exploration of TREM2 as a potential therapeutic target. Thus, the study of recombinant TREM2 protein not only elucidates its biological functions but also aims to advance our knowledge of its implications in neurodegenerative diseases, paving the way for novel treatment strategies.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US