Cat: IPD-X50128

Recombinant Human SUGCT Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    SUGCT

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    SUCHY

  • Species

    Human

  • Source

    E. coli

  • Tag

    N-terminal His-Tag

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q9HAC7

  • Expression Region

    32-438aa

  • AA Sequence

    QSDMNNIKPLEGVKILDLTRVLAGPFATMNLGDLGAEVIKVERPGAGDDTRTWG PPFVGTESTYYLSVNRNKKSIAVNIKDPKGVKIIKELAAVCDVFVENYVPGKLS AMGLGYEDIDEIAPHIIYCSITGYGQTGPISQRAGYDAVASAVSGLMHITGPEN GDPVRPGVAMTDLATGLYAYGAIMAGLIQKYKTGKGLFIDCNLLSSQVACLSHI AANYLIGQKEAKRWGTAHGSIVPYQAFKTKDGYIVVGAGNNQQFATVCKILDLP ELIDNSKYKTNHLRVHNRKELIKILSERFEEELTSKWLYLFEGSGVPYGPINNM KNVFAEPQVLHNGLVMEMEHPTVGKISVPGPAVRYSKFKMSEARPPPLLGQHTT HILKEVLRYDDRAIGELLSAGVVDQHETH

  • Molecular Weight

    47.8kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

GPLD1, or glycosylphosphatidylinositol-specific phospholipase D1, is an important enzyme involved in the metabolism of membrane lipids, specifically in the hydrolysis of glycosylphosphatidylinositols (GPIs), which anchor various proteins to the cell membrane. Its role extends beyond lipid metabolism; GPLD1 is implicated in cell signaling processes and immune responses, making it a critical player in both normal physiological functions and pathological conditions. Research on GPLD1 has gained momentum due to its potential significance in various diseases, including cancer, neurodegenerative disorders, and infections, where altered GPLD1 activity could influence disease progression and treatment outcomes. The recombinant expression of GPLD1 offers a valuable tool for studying its enzymatic properties and biological functions in detail. By producing GPLD1 in a controlled laboratory setting, researchers can investigate its biochemical characteristics, interactions with lipid substrates, and regulatory mechanisms. Furthermore, the generation of recombinant GPLD1 provides a platform for developing potential therapeutic agents that could modulate its activity, offering new avenues for treatment strategies targeting diseases associated with dysfunctional lipid metabolism or immune responses. Understanding the functional roles and regulatory pathways of GPLD1 through recombinant studies can yield insights into cellular processes and lead to advancements in biomedical research and therapeutic interventions.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US