Cat: PA1000-866DB

Recombinant Human DFFA Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    DFFA

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    DFFA;DFF1;DFF45;DNA fragmentation factor subunit alpha

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    O00273

  • Expression Region

    1-331aa

  • AA Sequence

    MGSSHHHHHHSSGLVPRGSHMEVTGDAGVPESGEIRTLKPCLLRRNYSRE QHGVAASCLEDLRSKACDILAIDKSLTPVTLVLAEDGTIVDDDDYFLCLP SNTKFVALASNEKWAYNNSDGGTAWISQESFDVDETDSGAGLKWKNVARQ LKEDLSSIILLSEEDLQMLVDAPCSDLAQELRQSCATVQRLQHTLQQVLD QREEVRQSKQLLQLYLQALEKEGSLLSKQEESKAAFGEEVDAVDTGISRE TSSDVALASHILTALREKQAPELSLSSQDLELVTKEDPKALAVALNWDIK KTETVQEACEWELALRLQQTQSLHSLRSISASKASPPGDLQNPKRARQDP T

  • Molecular Weight

    39 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

DFFA, or Death-Domain-Associated Protein, is an important protein in the study of apoptosis and cellular signaling. The DFFA gene encodes a protein that plays a critical role in programmed cell death, a fundamental process for maintaining cellular homeostasis and development. Research has shown that DFFA interacts with various cellular pathways and proteins, influencing the apoptotic signaling cascade. Understanding the structure and function of DFFA is crucial for elucidating its role in different biological processes, including cancer progression, neurodegenerative diseases, and immune responses. Recent advancements in biotechnology and recombinant protein expression systems have enabled researchers to produce and study DFFA in its purified form, which facilitates investigations into its molecular mechanisms. By exploring DFFA's interactions and post-translational modifications, scientists hope to uncover potential therapeutic targets for modulating apoptosis in diseases where this process is disrupted. Additionally, studying DFFA's role in various physiological and pathological contexts may reveal insights into its involvement in tumorigenesis and other diseases, paving the way for novel strategies in targeted therapies. Through continued research, DFFA is becoming increasingly recognized as a pivotal player in the regulation of cell death and survival, making it a significant focus of cellular biology and biomedicine.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US