Cat: PA1000-1044

Recombinant Human ERLIN2 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    ERLIN2

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    ERLIN2;C8orf2;SPFH2;Erlin-2

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    O94905

  • Expression Region

    25-339aa

  • AA Sequence

    MGSSHHHHHHSSGLVPRGSHMGSKIEEGHIGVYYRGGALLTSTSGPGFHL MLPFITSYKSVQTTLQTDEVKNVPCGTSGGVMIYFDRIEVVNFLVPNAVY DIVKNYTADYDKALIFNKIHHELNQFCSVHTLQEVYIELFDQIDENLKLA LQQDLTSMAPGLVIQAVRVTKPNIPEAIRRNYELMESEKTKLLIAAQKQK VVEKEAETERKKALIEAEKVAQVAEITYGQKVMEKETEKKISEIEDAAFL AREKAKADAECYTAMKIAEANKLKLTPEYLQLMKYKAIASNSKIYFGKDI PNMFMDSAGSVSKQFEGLADKLSFGLEDEPLETATKEN

  • Molecular Weight

    38 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

ERLIN2, a member of the ERLIN family, has garnered significant attention in recent years due to its vital role in various cellular processes. Initially identified in the context of endoplasmic reticulum (ER) function, ERLIN2 is believed to be involved in the regulation of quality control mechanisms within the ER, particularly in the degradation of misfolded proteins through the ER-associated degradation (ERAD) pathway. Research has suggested that ERLIN2 interacts with key components of the ubiquitin-proteasome system, which is crucial for maintaining cellular homeostasis. Furthermore, studies have indicated that ERLIN2 might play a role in modulating immune responses and cellular apoptosis, linking it to potential implications in diseases such as cancer and autoimmune disorders. The exploration of ERLIN2 as a recombinant protein offers promising avenues for understanding its structural characteristics and functional dynamics, which could lead to novel therapeutic strategies. Given its pivotal role in maintaining ER integrity and protein homeostasis, ERLIN2 represents a fascinating target for further investigation into its mechanistic pathways and biological significance.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US