Analytical Data
-
Gene name
CYP74A
- Application
-
Alternative Names
CYP74A；AOS；Allene oxide synthase. chloroplastic
-
Species
E.coli
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q96242
-
Expression Region
34-518aa
-
AA Sequence
SGSETPDLTVATRTGSKDLPIRNIPGNYGLPIVGPIKDRWDYFYDQGAEEFFKSRIRKYNSTVYRVNMPPGAFIAENPQVVALLDGKSFPVLFDVDKVEKKDLFTGTYMPSTELTGGYRILSYLDPSEPKHEKLKNLLFFLLKSSRNRIFPEFQATYSELFDSLEKELSLKGKADFGGSSDGTAFNFLARAFYGTNPADTKLKADAPGLITKWVLFNLHPLLSIGLPRVIEEPLIHTFSLPPALVKSDYQRLYEFFLESAGEILVEADKLGISREEATHNLLFATCFNTWGGMKILFPNMVKRIGRAGHQVHNRLAEEIRSVIKSNGGELTMGAIEKMELTKSVVYECLRFEPPVTAQYGRAKKDLVIESHDAAFKVKAGEMLYGYQPLATRDPKIFDRADEFVPERFVGEEGEKLLRHVLWSNGPETETPTVGNKQCAGKDFVVLVARLFVIEIFRRYDSFDIEVGTSPLGSSVNFSSLRKASF
-
Molecular Weight
61.9 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CYP74A is a member of the cytochrome P450 enzyme family, which plays a crucial role in the metabolism of various naturally occurring compounds, including fatty acids and various signaling molecules. This enzyme catalyzes the oxygenation of lipid substrates, leading to the formation of important signaling molecules such as jasmonates that are involved in plant defense responses and development. The study of CYP74A is essential for understanding its specific functions within the plant metabolic pathways and its interactions with other biochemical processes. The application of recombinant DNA technology to produce CYP74A allows for the detailed examination of its enzymatic activity, substrate specificity, and regulatory mechanisms. By producing recombinant CYP74A proteins, researchers can investigate their structure-function relationships and the molecular mechanisms that underlie their catalytic processes. Furthermore, understanding CYP74A‘s role can have implications for agricultural biotechnology, such as enhancing plant stress resistance or improving the nutritional quality of crops. Thus, the production and characterization of CYP74A recombinant proteins provide valuable insights into both fundamental plant biology and potential practical applications in crop improvement.
