Analytical Data
-
Gene name
gel4
- Application
-
Alternative Names
gel4；1.3-beta-glucanosyltransferase gel4
-
Species
E.coli
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P0C956
-
Expression Region
1-548aa
-
AA Sequence
MKFVYAAAGASLVGSALATLPVIEAKVLKACCWTIALDANSYGNKFFYSNNGTEFFIRGVAYQQEYQANGTSTENSDYTDPLANVDNCKRDIPYLKQLRTNVIRTYAVDPTKDHDECMKLLDDAGIYLITDLSAPSESINRADPAWNTDLYKRYTSVIDAFAKYSNVIGFFAGNEVANDNNNTNSIAYVKAAVRDMKSYIKSKDYRSSLLVGYATDDDAHIRADLADYLVCGDKESSIDMFGYNIYEWCGDSSFEKSGYKDRTEEFSKYPVPAFFSEYGCIDPKPRKFTDVAALYGPQMNDVWSGGIVYMYFQEANDYGLVSVSGDNVKTKEDFSYLSVQMQKVTATGVNSASYTASNTAVPTCPSVGAKWEASNKLPPSPNSELCDCMVETLSCTVKDSVDEKEYGDLFDYLCAAGVCGGINSNSTSGDYGAYSVCSAKQKLSFVMNQYYKKNNKAATACDFDGKAQTKKGADASGSCASLISQAGTAGTGSVTAGATGSSGSGSASETSKGAAGVAASPMAVKVGNWQFGAYIATALFAGVGMLVL
-
Molecular Weight
58.8 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Gel4, a recombinant protein derived from the Gelonin family, has garnered significant attention in the field of biomedicine due to its unique properties. Originally identified in the seeds of the plant Gelonium multiflorum, Gel4 exhibits potent antitumor and antiviral activities, making it a promising candidate for therapeutic applications. Researchers have been particularly interested in its ability to inhibit protein synthesis in eukaryotic cells by targeting the ribosomal RNA, leading to apoptosis in cancer cells. The protein's mechanism of action and potential for targeted drug delivery systems are under extensive investigation, especially in combination therapies for resistant cancers and viral infections. Furthermore, advancements in genetic engineering techniques have allowed for more efficient production and modification of Gel4, enhancing its therapeutic efficacy and stability. The increasing prevalence of drug-resistant pathogens in recent years underscores the need for innovative treatments, positioning Gel4 as a crucial component in the ongoing quest for effective biopharmaceuticals. Studies are also exploring its role in targeted toxin delivery, maximizing its specificity and minimizing side effects. As research unfolds, Gel4 is expected to play a vital role in developing next-generation therapeutic strategies, highlighting the importance of exploring plant-derived proteins in modern medicine.
