Analytical Data
-
Gene name
PLAC1
- Application
-
Alternative Names
PLAC1;Placenta-specific Protein 1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9HBJ0
-
Expression Region
23-212aa
-
AA Sequence
QSPMTVLCSIDWFMVTVHPFMLNNDVCVHFHELHLGLGCPPNHVQPHAYQFTYRVTECGIRAKAVSQDMVIYSTEIHYSSKGTPSKFVIPVSCAAPQKSPWLTKPCSMRVASKSRATAQKDEKCYEVFSLSQSSQRPNCDCPPCVFSEEEHTQVPCHQAGAQEAQPLQPSHFLDISEDWSLHTDDMIGSM
-
Molecular Weight
23.3 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
PLAC1 (placenta-specific 1) is a gene that encodes a protein primarily expressed in trophoblasts during early pregnancy and has been implicated in various reproductive and developmental processes. Initially identified for its specific expression in placental tissues, PLAC1 has garnered interest for its potential roles in cell proliferation, differentiation, and immune modulation. Research indicates that PLAC1 might be involved in the development of certain cancers due to its effects on cell growth and survival mechanisms, as well as its ability to influence immune responses in the tumor microenvironment. This dual role in reproductive biology and oncology has propelled investigations into the therapeutic potential of PLAC1. Recombining the PLAC1 protein has become crucial for understanding its function and interactions at the molecular level, which could provide insights into its role during gestation and its implications in tumor biology. The preparation and characterization of recombinant PLAC1 protein facilitate more precise studies, enabling researchers to explore its pathways and interactions with other proteins, and evaluate its utility as a biomarker or therapeutic target. Given the complexity of its action in both reproductive tissue and tumor contexts, detailed studies on PLAC1 promise to unravel its multifaceted roles and enhance our understanding of both normal physiological processes and disease states.











