Analytical Data
-
Gene name
HPCA
- Application
-
Alternative Names
HPCA；BDR2；Neuron-specific calcium-binding Protein hippocalcin
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P84074
-
Expression Region
2-193aa
-
AA Sequence
GKQNSKLRPEMLQDLRENTEFSELELQEWYKGFLKDCPTGILNVDEFKKIYANFFPYGDASKFAEHVFRTFDTNSDGTIDFREFIIALSVTSRGRLEQKLMWAFSMYDLDGNGYISREEMLEIVQAIYKMVSSVMKMPEDESTPEKRTEKIFRQMDTNNDGKLSLEEFIRGAKSDPSIVRLLQCDPSSASQF
-
Molecular Weight
29.7 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
HPCA (High-Performance Chimeric Antigen Receptor) recombinant proteins have garnered significant attention in recent years due to their potential applications in targeted immunotherapy, particularly in cancer treatment. The background of HPCA research stems from the growing need for more effective therapeutic strategies to combat malignancies that are resistant to conventional methods such as chemotherapy and radiation. HPCA utilizes advanced genetic engineering techniques to create chimeric antigen receptors, which can effectively recognize and bind to specific tumor-associated antigens on cancer cells. This precision enables the targeted destruction of tumor cells while minimizing damage to healthy tissues. The ability to customize these receptors enhances their efficacy and adaptability in various types of cancers, paving the way for personalized medicine approaches. Moreover, the exploration of HPCA recombinant proteins has expanded beyond oncology, with potential applications in autoimmune diseases and infectious diseases, highlighting the versatility of this technology. Ongoing research aims to optimize the design, expression, and delivery of these proteins, along with assessing their safety and efficacy through preclinical and clinical trials. As a result, HPCA recombinant proteins represent a promising frontier in biotherapeutics, offering hope for improved treatment outcomes for patients facing challenging illnesses.
