Cat: PA1000-2801

Recombinant Human RWDD4 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    RWDD4

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    RWDD4;FAM28A;RWDD4A;RWD domain-containing Protein 4

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q6NW29

  • Expression Region

    1-188aa

  • AA Sequence

    MGSSHHHHHHSSGLVPRGSHMGSMSANEDQEMELEALRSIYEGDESFREL SPVSFQYRIGENGDPKAFLIEISWTETYPQTPPILSMNAFFNNTISSAVK QSILAKLQEA VEANLGTAMT YTLFEYAKDN KEQFMENHNP INSATSISNI ISIETPNTAPSSKKKDKKEQLSKAQKRKLADKTDHKGELPRGWNWVDVVK HLSKTGSKDDE

  • Molecular Weight

    24 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

RWDD4 (Ring Finger and WD Repeat Domain 4) is a relatively understudied protein that has garnered interest due to its potential roles in various cellular processes, including the regulation of gene expression, cellular signaling, and immune responses. Research indicates that RWDD4 may function as an E3 ubiquitin ligase, a critical enzyme that tags proteins for degradation, thereby influencing cellular homeostasis and turnover. Patterns of RWDD4 expression have been linked to several diseases, including cancer, where its dysregulation could contribute to tumor progression and metastasis. The investigation into RWDD4's structure and function is essential for understanding its biological significance and therapeutic potential. Recent advances in proteomics and molecular biology techniques have enabled researchers to delve deeper into RWDD4's interactions with other cellular components and its impact on different signaling pathways. Additionally, studies exploring its role in stress response and inflammation may reveal new insights into its involvement in various pathological conditions. Given the increasing evidence of RWDD4's multifaceted roles, ongoing research aims to delineate its mechanistic pathways and evaluate its potential as a biomarker or therapeutic target in diseases where its function is compromised.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US