Analytical Data
-
Gene name
SIRPG
- Application
-
Alternative Names
SIRPG;SIRPB2;Signal-regulatory Protein gamma
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9P1W8
-
Expression Region
29-364aa
-
AA Sequence
EEELQMIQPEKLLLVTVGKTATLHCTVTSLLPVGPVLWFRGVGPGRELIY NQKEGHFPRVTTVSDLTKRNNMDFSIRISSITPADVGTYYCVKFRKGSPE NVEFKSGPGTEMALGAKPSAPVVLGPAARTTPEHTVSFTCESHGFSPRDI TLKWFKNGNELSDFQTNVDPTGQSVAYSIRSTARVVLDPWDVRSQVICEV AHVTLQGDPLRGTANLSEAIRVPPTLEVTQQPMRVGNQVNVTCQVRKFYP QSLQLTWSENGNVCQRETASTLTENKDGTYNWTSWFLVNISDQRDDVVLT CQVKHDGQLAVSKRLALEVTVHQKDQSSDATPGPAS
-
Molecular Weight
64 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
SIRPG (Signal Regulatory Protein Gamma) is a member of the SIRP family, which plays a crucial role in regulating immune responses and cellular interactions. Recent research has highlighted its significance in modulating immune checkpoint pathways and influencing the behavior of various immune cells, including macrophages and T cells. The study of SIRPG recombinant proteins has garnered attention due to their potential applications in cancer immunotherapy and autoimmunity treatment. Understanding the structure and function of SIRPG can provide insight into its mechanism of action and interaction with other immune receptors. Furthermore, the development of SIRPG-based therapeutic strategies could enhance the efficacy of existing immunotherapies by augmenting the immune response against tumors or regulating hyperactive immune responses in autoimmune diseases. By exploring the biochemical and biophysical properties of SIRPG recombinant proteins, researchers aim to uncover new avenues for targeted therapies that can precisely manipulate immune activity for improved patient outcomes. This research is especially pertinent in the context of the rapidly advancing field of immunotherapy, where novel targets and strategies are continually being sought to overcome challenges such as immune evasion by tumors and the need for more personalized therapeutic approaches.
