Analytical Data
-
Gene name
RS1
- Application
-
Alternative Names
RS1；XLRS1；Retinoschisin
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O15537
-
Expression Region
24-224aa
-
AA Sequence
STEDEGEDPWYQKACKCDCQGGPNALWSAGATSLDCIPECPYHKPLGFESGEVTPDQITCSNPEQYVGWYSSWTANKARLNSQGFGCAWLSKFQDSSQWLQIDLKEIKVISGILTQGRCDIDEWMTKYSVQYRTDERLNWIYYKDQTGNNRVFYGNSDRTSTVQNLLRPPIISRFIRLIPLGWHVRIAIRMELLECVSKCA
-
Molecular Weight
27.0 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
RS1 (retinoschisin 1) is a secreted protein primarily expressed in the retina, playing a crucial role in retinal cell adhesion and communication. Mutations in the RS1 gene are linked to X-linked retinoschisis, a hereditary retinal disorder that leads to vision impairment and often results in retinal detachment. This condition primarily affects males, as it is X-linked, and can manifest early in life. The study of RS1 has garnered attention due to its pivotal role in maintaining the structural integrity of the retina. Researchers have focused on understanding the molecular mechanisms by which RS1 facilitates intercellular interactions among retinal cells, as well as its implications in cellular signaling pathways. Additionally, RS1's potential as a therapeutic target has been explored, with approaches ranging from gene therapy to protein replacement strategies. The pursuit of RS1-related studies aims not only to enhance our comprehension of retinal disorders but also to develop innovative treatment modalities that could restore vision and improve the quality of life for individuals affected by retinoschisis and related diseases.
