Analytical Data
-
Gene name
RSBN1
- Application
-
Alternative Names
RSBN1Lysine-specific demethylase 9; KDM9; EC 1.14.11.-; Round spermatid basic protein 1
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q5VWQ0
-
Expression Region
1-411 aa
-
AA Sequence
MAAQVGAVRVVRAVAAQEEPDKEGKEKPHAGVSPRGVKRQRRSSSGGSQEKRGRPSQEPPLAPPHRRRRSRQHPGPLPPTNAAPTVPGPVEPLLLPPPPPPSLAPAGPAVAAPLPAPSTSALFTFSPLTVSAAGPKHKGHKERHKHHHHRGPDGDPSSCGTDLKHKDKQENGERTGGVPLIKAPKRETPDENGKTQRADDFVLKKIKKKKKKKHREDMRGRRLKMYNKEVQTVCAGLTRISKEILTQGQINSTSGLNKESFRYLKDEQLCRLNLGMQEYRVPQGVQTPFMTHQEHSIRRNFLKTGTKFSNFIHEEHQSNGGALVLHAYMDELSFLSPMEMERFSEEFLALTFSENEKNAAYYALAIVHGAAAYLPDFLDYFAFNFPNTPVKMEILGKKDIETTTISNFHTQ
-
Molecular Weight
72.1 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
RSBN1 (RING Finger and BCL2 Homology 3 Domain-Containing Protein 1) is a protein that has garnered attention due to its potential implications in cancer biology and cell signaling pathways. Initially identified as a gene with roles in the regulation of apoptosis and cell proliferation, RSBN1 exhibits a unique structure featuring a RING-type zinc finger motif, indicating its potential function as a ubiquitin ligase. Research indicates that abnormal expression levels of RSBN1 may be associated with various malignancies, making it a subject of interest for understanding tumorigenesis and cancer progression. Furthermore, findings suggest that RSBN1 may interact with key signaling molecules, influencing pathways such as the PI3K/Akt and NF-kB pathways, which are critical for cell survival and proliferation. As a result, the recombinant expression of RSBN1 has become a focus for researchers aiming to elucidate its functional roles and therapeutic potential. Investigating RSBN1 as a novel biomarker or therapeutic target could pave the way for developing innovative strategies in cancer treatment and diagnostic applications, presenting an exciting avenue for future research and clinical translation.
