Analytical Data
-
Gene name
CUL7
- Application
-
Alternative Names
MVGELRYREFRVPLGPGLHAYPDELIRQRVGHDGHPEYQIRWLILRRGDEGDGGSGQVDCKAEHILLWMSKDEIYANCHKMLGEDGQVIGPSQESAGEVG
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q14999
-
Expression Region
1-100aa
-
AA Sequence
MVGELRYREFRVPLGPGLHAYPDELIRQRVGHDGHPEYQIRWLILRRGDEGDGGSGQVDCKAEHILLWMSKDEIYANCHKMLGEDGQVIGPSQESAGEVG
-
Molecular Weight
36.63 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CUL7 (Cullin-7) is a member of the cullin family of proteins that plays a crucial role in the ubiquitin-proteasome system, which regulates protein degradation and cellular processes. Dysregulation of CUL7 has been implicated in various diseases, including cancer and genetic disorders. Research into CUL7 recombinant proteins has gained traction due to their potential to uncover the mechanisms underlying these conditions. The study of CUL7's structure and function, particularly through the generation of recombinant versions of the protein, allows scientists to explore its interactions with substrates and other components of the E3 ubiquitin ligase complex. Moreover, as mutations in the CUL7 gene can lead to disorders like 3-M syndrome, understanding its biochemical pathways may provide insights for therapeutic strategies. Recombinant CUL7 proteins can be utilized in biochemical assays to screen for small molecules that modulate its activity, offering prospects for drug development. Overall, the investigation of CUL7 recombinant proteins serves as a vital tool in elucidating the complexities of cell regulation and disease pathology, making it a significant focus of modern biomedical research.
