Analytical Data
-
Gene name
SLC35A3
- Application
-
Alternative Names
SLC35A3; UDP-N-acetylglucosamine transporter; Golgi UDP-GlcNAc transporter; Solute carrier family 35 member A3
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9Y2D2
-
Expression Region
1-220 aa
-
AA Sequence
MFANLKYVSLGILVFQTTSLVLTMRYSRTLKEEGPRYLSSTAVVVAELLKIMACILLVYKDSKCSLRALNRVLHDEILNKPMETLKLAIPSGIYTLQNNLLYVALSNLDAATYQVTYQLKILTTALFSVSMLSKKLGVYQWLSLVILMTGVAFVQWPSDSQLDSKELSAGSQFVGLMAVLTACFSSGFAGVYFEKILKETKQSVWIRNIQLVSFSLEPSL
-
Molecular Weight
50.9 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
SLC35A3, a member of the solute carrier family, encodes a nucleotide sugar transporter that plays a crucial role in cellular carbohydrate metabolism and glycosylation processes. Mutations in the SLC35A3 gene have been linked to a spectrum of genetic disorders, including congenital disorders of glycosylation (CDG), characterized by defective glycan biosynthesis and resultant cellular dysfunction. The protein is primarily responsible for transporting nucleotide sugars such as UDP-galactose and CMP-sialic acid into the Golgi apparatus, where they are essential for glycoprotein and glycolipid synthesis. Understanding the structure and function of SLC35A3 is vital for elucidating the molecular mechanisms underlying these disorders and developing potential therapeutic strategies. Recent advances in recombinant protein technology have enabled the production of SLC35A3 in heterologous systems, facilitating detailed biochemical and biophysical characterization. Research on SLC35A3 recombinant protein aims to uncover its transport mechanisms, substrate specificity, and interactions with other cellular components, providing insights into its role in health and disease. The knowledge gained from these studies is expected to pave the way for novel diagnostic and treatment options for patients affected by disorders linked to SLC35A3 dysfunction.
