Analytical Data
-
Gene name
CEMP1
- Application
-
Alternative Names
CEMP1；Cementoblastoma-derived Protein 1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q6PRD7
-
Expression Region
1-247aa
-
AA Sequence
MGTSSTDSQQAGHRRCSTSNTSAENLTCLSLPGSPGKTAPLPGPAQAGAGQPLPKGCAAVKAEVGIPAPHTSQEVRIHIRRLLSWAAPGACGLRSTPCALPQALPQARPCPGRWFFPGCSLPTGGAQTILSLWTWRHFLNWALQQREENSGRARRVPPVPRTAPVSKGEGSHPPQNSNGEKVKTITPDVGLHQSLTSDPTVAVLRAKRAPEAHPPRSCSGSLTARVCHMGVCQGQGDTEDGRMTLMG
-
Molecular Weight
28.0kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Identification
Protein Description
CEMP1 (cementum protein 1) is an intriguing protein that plays a crucial role in the development and mineralization of cementum, a specialized dental tissue that covers the roots of teeth. Given its pivotal role in dental health and potential implications in periodontal disease, the study of CEMP1, particularly its recombinant form, has garnered significant attention. Recent advancements in protein engineering have enabled researchers to produce recombinant CEMP1, allowing for in-depth characterization of its biological functions and interactions. Understanding CEMP1's mechanisms can shed light on the processes involved in tooth root attachment and the pathophysiology of periodontal conditions. Moreover, CEMP1's potential applications in regenerative dentistry and tissue engineering underscore the importance of study into its regenerative properties. As periodontal diseases remain prevalent worldwide, innovative approaches utilizing CEMP1 could pave the way for novel therapeutic strategies aimed at promoting periodontal regeneration and improving oral health outcomes. Research into CEMP1 not only enhances our basic understanding of dental biology but also holds promise for translating scientific discoveries into clinical applications.
