Analytical Data
-
Gene name
PROLM25
- Application
-
Alternative Names
PROLM25；RP6；13 kDa prolamin C
-
Species
E.coli
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P17048
-
Expression Region
20-156aa
-
AA Sequence
RFDPLSQSYRQYQLQSHLLLQQQVLSPCSEFVRQQYSIVATPFWQPATFQLINNQVMQQQCCQQLRLVAQQSHYQAISIVQAIVQQLQLQQFSGVYFDQTQAQAQTLLTFNLPSICGIYPNYYSAPRSIATVGGVWY
-
Molecular Weight
21.9 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
PROLM25 is a novel recombinant protein that has garnered significant attention in the field of molecular biology and biochemistry due to its potential applications in therapeutics and diagnostics. The research surrounding PROLM25 stems from its affiliation with the prolyl oligopeptidase family of enzymes, which are known to play critical roles in protein maturation and regulation. In particular, PROLM25 has been implicated in various physiological processes, including cell signaling, immune response modulation, and developmental regulation. Recent studies have highlighted its unique structure and functional properties, suggesting that it may have specific interactions with molecular targets involved in disease pathways. The production of PROLM25 as a recombinant protein allows for detailed characterization and functional assays, enabling researchers to explore its mechanistic roles and therapeutic potential. Moreover, the increasing prevalence of diseases associated with dysregulated protein interactions emphasizes the importance of studying PROLM25, as it may offer insights into novel treatment strategies. Ongoing research aims to elucidate the precise biochemical pathways influenced by PROLM25 and assess its efficacy as a biomarker or a therapeutic agent in clinical settings. As such, the investigation of PROLM25 represents a promising avenue for advancing our understanding of complex biological systems and developing innovative solutions for unmet medical needs.
