Cat: PAX2000-11690

Recombinant Human ST3GAL6 Protein,GST

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    ST3GAL6

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    Type 2 lactosamine alpha-2.3-sialyltransferase. EC:2.4.3.6. CMP-NeuAc:beta-galactoside alpha-2.3-sialyltransferase VI. ST3Gal VI. ST3GalVI. Sialyltransferase 10

  • Species

    Human

  • Source

    E. coli

  • Tag

    GST-tag at N-terminal

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q9Y274

  • Expression Region

    145-240 aa

  • AA Sequence

    MNNGPVLGHEEEVGRRTTFRLFYPESVFSDPIHNDPNTTVILTAFKPHDLRWLLELLMGDKINTNGFWKKPALNLIYKPYQIRILDPFIIRTAAYE

  • Molecular Weight

    36.3 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

ST3GAL6, a member of the sialyltransferase family, plays a crucial role in the post-translational modification of glycoproteins and glycolipids through the addition of sialic acid residues. These modifications are essential for various biological processes, including cell-cell interactions, immune response, and tumor progression. Research has shown that altered expression of ST3GAL6 is linked to several pathological conditions, including cancers and inflammatory diseases, suggesting its potential as a therapeutic target or biomarker. The reconstitution and expression of ST3GAL6 as a recombinant protein enable detailed studies of its enzymatic activity, substrate specificity, and regulatory mechanisms. Understanding its structure-function relationship could provide insights into its role in glycosylation pathways and offer opportunities for developing novel strategies to modulate sialylation, which may have therapeutic implications in diseases characterized by aberrant glycosylation patterns. This research area is significant in enhancing our understanding of cell biology and disease mechanisms, paving the way for innovative treatment approaches.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US