Analytical Data
-
Gene name
ST3GAL2
- Application
-
Alternative Names
3-GalNAc-alpha-2; 3-sialyltransferase 2; 3-sialyltransferase; 3-ST 2; Alpha 2; Alpha 2.3-ST; Beta-galactoside alpha-2; Beta-galactoside alpha-2.3-sialyltransferase; CMP N-acetylneuraminate beta galactosamide alpha 2.3 sialyltransferase; CMP-N-acetylneuraminate-beta-galactosamide-alpha-2; Gal NAc6S; Gal-beta-1; Gal-NAc6S; SIA4B_HUMAN; sialyltransferase 4B (beta-galactosidase alpha-2.3-sialytransferase); Sialyltransferase 4B; SIAT4-B; SIAT4B; ST3 beta-galactoside alpha-2.3-sialyltransferase 2; ST3Gal II; ST3GAL2; ST3GalA.2; ST3GalII
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q16842
-
Expression Region
1-350 aa
-
AA Sequence
MKCSLRVWFLSVAFLLVFIMSLLFTYSHHSMATLPYLDSGALDGTHRVKLVPGYAGLQRLSKERLSGKSCACRRCMGDAGASDWFDSHFDGNISPVWTRENMDLPPDVQRWWMMLQPQFKSHNTNEVLEKLFQIVPGENPYRFRDPHQCRRCAVVGNSGNLRGSGYGQDVDGHNFIMRMNQAPTVGFEQDVGSRTTHHFMYPESAKNLPANVSFVLVPFKVLDLLWIASALSTGQIRFTYAPVKSFLRVDKEKVQIYNPAFFKYIHDRWTEHHGRYPSTGMLVLFFALHVCDEVNVYGFGADSRGNWHHYWENNRYAGEFRKTGVHDADFEAHIIDMLAKASKIEVYRGN
-
Molecular Weight
64.24 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ST3GAL2, a gene encoding the enzyme UDP-galactose:beta-N-acetylgalactosamine beta-1,3-galactosyltransferase 2, plays a critical role in glycosylation processes, impacting various biological functions and pathways. Abnormalities in ST3GAL2 expression and activity have been linked to several diseases, including certain types of cancer and neurodegenerative disorders. Research has shown that ST3GAL2 is involved in the synthesis of glycan structures on cell surfaces, which can influence cell interactions, signaling pathways, and immune responses. The recombinantly expressed ST3GAL2 protein enables researchers to study its enzymatic activity and glycosylation patterns in detail, facilitating the understanding of its role in health and disease. Additionally, investigations into its structure-function relationships may uncover potential therapeutic targets for modulating its activity in pathological conditions. Thus, the study of ST3GAL2 recombinant protein is not only vital for elucidating fundamental biological processes but also holds promise for developing novel strategies in disease intervention and treatment.
